iran-infrastructure / mirror.myclassrz.online
● SSL Verified HTTP & HTTPS Active IP: 188.121.104.188

National Offline Mirror Hub

100% Standalone Runtimes, Pre-built Python Wheels & Sanaei 3X-UI for Iran Network

📦 PIP Mirror (226) 🐍 Python (6 Versions) 🚀 3X-UI Bundles
PIP / PyPI Simple Repository (PEP 503 Mirror)
226 Projects / 287 Wheels

Pre-compiled binary wheels with complete dependency closure. Zero compiler (gcc/make) needed on target servers.

1. One-click Automated Configuration (Sets global pip.conf for current user & system):
bash (run as root or standard user)
curl -sSL https://mirror.myclassrz.online/pip/setup-pip.sh | bash
2. Install Packages via Standard PIP (Full Offline Speed):
bash (terminal)
pip install aiogram fastapi uvicorn redis aiohttp pyrogram tgcrypto yt-dlp
Direct flag without configuring global pip.conf
pip install --index-url https://mirror.myclassrz.online/pip/simple/ --trusted-host mirror.myclassrz.online aiogram
Browse Indexed Packages: Open PEP 503 Index (/pip/simple/) →
aiogramfastapiuvicornpyrogramtelethontgcryptoaiohttphttpxrequestswebsocketsredissqlalchemyasyncpgpydanticpydantic-corecryptographyyt-dlpcelerybeautifulsoup4lxmlpillowuvloopmsgspecpython-telegram-botpycryptodomepsutilpytestrich
Python Multi-Version Standalone Mirror (6 Stable Versions)
x86_64 & aarch64

Installs fully relocatable, optimized Python runtimes with built-in pip, SSL & SQLite without interfering with Ubuntu system packages.

Terminal One-Liner (Interactive Menu & Fast Setup)
curl -sSL https://mirror.myclassrz.online/python/install.sh | bash
Version Type Target Workloads Supported Architectures Tarball Package
Python 3.8.20 LTS Legacy scripts & backward compatibility x86_64 / aarch64 Download (~20MB)
Python 3.9.20 Stable Lightweight microservices x86_64 / aarch64 Download (~20MB)
Python 3.10.22 Standard Telegram bots & web scrapers x86_64 / aarch64 Download (~28MB)
Python 3.11.17 Recommended Ultra-fast Aiogram 3 & high concurrency x86_64 / aarch64 Download (~29MB)
Python 3.12.15 Standard Ubuntu 24.04 LTS official baseline x86_64 / aarch64 Download (~33MB)
Python 3.13.17 Latest JIT compiler enabled runtime x86_64 / aarch64 Download (~34MB)
Sanaei 3X-UI (v3.10.2) Offline Packages
Zero-Dependency

Completely stripped of external GitHub API checks and external IP lookups. Embedded GeoIP, Geosite (Iran rules), and 10-year IP SAN certificate.

AMD64 Server Install Command (One-Click)
curl -fLO https://mirror.myclassrz.online/sanaei-v3.10.2-offline-amd64.tar.gz && tar -zxf sanaei-v3.10.2-offline-amd64.tar.gz && cd sanaei-v3.10.2-offline-amd64 && sudo bash install.sh
Architecture Size Bundle File SHA-256 Checksum
AMD64 / x86_64 80 MB sanaei-v3.10.2-offline-amd64.tar.gz View Checksum
ARM64 / aarch64 76 MB sanaei-v3.10.2-offline-arm64.tar.gz View Checksum
Universal Bundle (All Arches) 533 MB sanaei-v3.10.2-offline-UNIVERSAL.tar.gz View Checksum
Network Gateway & Connectivity Reference

Secure HTTPS Domain

https://mirror.myclassrz.online
Port 443 with TLS 1.3 & HTTP/2

Direct HTTP Domain

http://mirror.myclassrz.online
Port 80 (No forced redirect)

Direct IP Access (DNS-Immune)

http://188.121.104.188
Use during national internet blackout

Backend Dedicated Port

http://188.121.104.188:8888
Direct Python Threading Server